missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human WDR13 (aa 107-214) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91923
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51483 (PA5-51483. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
WDR13 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. WDR13 gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined. This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined.Spécifications
Q9H1Z4 | |
Blocking Assay, Control | |
64743 | |
100 μL | |
1700060B08Rik; 5730411P10Rik; DXHXS7467e; LOW QUALITY PROTEIN: WD repeat-containing protein 13; memory-related protein; MG21; mMg21; RGD1560982; W51679; WD repeat domain 13; WD repeat domain 13 protein; WD repeat-containing protein 13; Wdr13 | |
WDR13 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human WDR13 (aa 107-214) Control Fragment | |
RUO | |
WDR13 | |
Unconjugated | |
Recombinant | |
GHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVPAPPTVLRVLR | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |