missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RPL34 (aa 55-86) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109830
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145144 (PA5-145144. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L34E family of ribosomal proteins. It is located in the cytoplasm. This gene originally was thought to be located at 17q21, but it has been mapped to 4q. Transcript variants derived from alternative splicing, alternative transcription initiation sites, and/or alternative polyadenylation exist; these variants encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008].Spécifications
P49207 | |
Blocking Assay, Control | |
6164 | |
100 μL | |
1100001I22Rik; 60 S ribosomal protein L34; L34; Large ribosomal subunit protein eL34; leukemia-associated protein; ribosomal protein L34; ribosomal protein L34-like 2; RL34; RPL34; Rpl34l2 | |
RPL34 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human RPL34 (aa 55-86) Control Fragment | |
RUO | |
RPL34 | |
Unconjugated | |
Recombinant | |
GVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKC | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |