missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PNPLA5 (aa 248-309) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100054
Description
Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62185 (PA5-62185. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene is a member of the patatin-like phospholipase family; its encoded protein has been shown to inhibit transacylation. Multiple transcript variants encoding different isoforms have been found for this gene.Spécifications
Q7Z6Z6 | |
Blocking Assay, Control | |
150379 | |
100 μL | |
dJ388M5; dJ388M5.4; GS2L; GS2-like protein; patatin like phospholipase domain containing 5; patatin-like phospholipase domain containing 5; patatin-like phospholipase domain-containing protein 5; PNPLA5 | |
PNPLA5 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PNPLA5 (aa 248-309) Control Fragment | |
RUO | |
PNPLA5 | |
Unconjugated | |
Recombinant | |
LRFLERRGLTKEPVLWTLVSKEPPAPADGNWDAGCDQRWKGGLSLNWKVPHVQVKDVPNFEQ | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |