missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human KLHL29 (aa 773-848) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109856
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144759 (PA5-144759. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
KLHL29 (Kelch-like protein 29), also known as KBTBD9, is a 655 amino acid protein that is related to the Drosophila Kelch protein. Mutations affecting Kelch function result in failure of Kelch to associate with the ring canals and subsequent female sterility. Human KLHL29 contains six kelch repeats and one BTB (POZ) domain. The BTB (Broad-Complex, Tramtrack and Bric a brac) domain, also known as the POZ (Poxvirus and Zinc finger) domain, is an N-terminal homodimerization domain that contains multiple copies of kelch repeats and/or C2H2-type zinc fingers. Proteins that contain BTB domains are thought to be involved in transcriptional regulation via control of chromatin structure and function. KLHL29 exists as two alternatively spliced isoforms which are encoded by a gene that maps to human chromosome 2p24.1.Spécifications
Q96CT2 | |
Blocking Assay, Control | |
114818 | |
100 μL | |
A230106N14Rik; Gm68; KBTBD9; kelch like family member 29; kelch repeat and BTB (POZ) domain containing 9; kelch repeat and BTB domain-containing protein 9; kelch-like 29; kelch-like family member 29; kelch-like protein 29; Kiaa1921; Klhl29; mKIAA1921 | |
KLHL29 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human KLHL29 (aa 773-848) Control Fragment | |
RUO | |
KLHL29 | |
Unconjugated | |
Recombinant | |
AVTLNGFVFILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNMEAYEPTTN | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |