missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human INHA (aa 104-183) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91943
Description
Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82667 (PA5-82667. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The inhibin alpha subunit joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone.Spécifications
P05111 | |
Blocking Assay, Control | |
3623 | |
100 μL | |
A inhibin subunit; A-inhibin subunit; AW555078; IHA; Inha; inhibin; inhibin alpha; inhibin alpha chain; inhibin alpha subunit | |
INHA | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human INHA (aa 104-183) Control Fragment | |
RUO | |
INHA | |
Unconjugated | |
Recombinant | |
QEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLAT | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |