missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FGD1 (aa 32-137) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91933
Description
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51482 (PA5-51482. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
FGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome.Spécifications
| P98174 | |
| Blocking Assay, Control | |
| 2245 | |
| 100 μL | |
| AAS; faciogenital dysplasia 1 protein; Faciogenital dysplasia 1 protein homolog; faciogenital dysplasia protein; Fgd1; FGDY; FYVE, RhoGEF and PH domain containing 1; FYVE, RhoGEF and PH domain containing 1 (faciogenital dysplasia); FYVE, RhoGEF and PH domain-containing protein 1; MRXS16; Rho/Rac GEF; rho/Rac guanine nucleotide exchange factor FGD1; ZFYVE3; zinc finger FYVE domain-containing protein 3 | |
| FGD1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FGD1 (aa 32-137) Control Fragment | |
| RUO | |
| FGD1 | |
| Unconjugated | |
| Recombinant | |
| DSDPGASEPGLLARRGSGSALGGPLDPQFVGPSDTSLGAAPGHRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPGQSLEPHPEGPQRLRSDP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |