missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Calumenin (aa 74-128) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109870
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144996 (PA5-144996. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Caluminin is a 315 amino acid Ca2+-binding member of the CREC, EF-hand protein family. Calumenin is a secreted protein t hat contains six Ca2+-binding (EF-hand) motifs and is expressed in the lumen of the endoplasmic reticulum (ER) and Golgi apparatus. In the presence of Ca2+, Calumenin interacts with serum amyloid P component (SAP) and, together, they may play a role in the immunological defense system and participate in amyloidosis, the pathological formation of amyloid deposits in different types of tissues. Calumenin has an inhibitory effect on the vitamin K-dependent g-carboxylation system which converts vitamin K-dependent proteins to Gla-containing proteins. Calumenin may also be involved in the pathophysiology of thrombosis and/or wound healing by acting in an autocrine or paracrine manner.Spécifications
O43852 | |
Blocking Assay, Control | |
813 | |
100 μL | |
9530075H20Rik; CALU; Calumenin; Cbp50; CBP-50; Crocalbin; crocalbin-like protein; IEF SSP 9302; multiple EF-hand protein; Rcn; reticulocalbin | |
Calu | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Calumenin (aa 74-128) Control Fragment | |
RUO | |
Calumenin | |
Unconjugated | |
Recombinant | |
GKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |