missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C1ql1 (aa 178-220) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109861
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145002 (PA5-145002. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
C1QL1 gene ontology annotations related to this gene include maintenance of synapse structure; motor learning; neuron remodeling.Spécifications
O75973 | |
Blocking Assay, Control | |
10882 | |
100 μL | |
C1q and tumor necrosis factor-related protein 14; C1q related factor; C1q/TNF-related protein 14; C1ql1; C1q-related factor; C1QRF; C1QTNF14; complement C1q like 1; Complement component 1 Q subcomponent-like 1; complement component 1, q subcomponent-like 1; CRF; CTRP14; gliacolin; LOW QUALITY PROTEIN: C1q-related factor | |
C1QL1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human C1ql1 (aa 178-220) Control Fragment | |
RUO | |
C1ql1 | |
Unconjugated | |
Recombinant | |
YHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |