missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ARPIN (aa 1-74) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104320
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59204 (PA5-59204. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ARPIN gene ontology annotations related to this gene include negative regulation of actin nucleation.Spécifications
| Q7Z6K5 | |
| Blocking Assay, Control | |
| 348110 | |
| 100 μL | |
| 2610034B18Rik; actin related protein 2/3 complex inhibitor; actin-related protein 2/3 complex inhibitor; arp2/3 inhibition protein; Arpin; C15orf38; C21H15orf38; C3H15orf38; C7H15orf38; hypothetical protein LOC550477; RGD1311021; RIKEN cDNA 2610034B18 gene; si:ch211-200o3.3; UPF0552 protein C15orf38; UPF0552 protein C15orf38 homolog; zgc:112432 | |
| ARPIN | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ARPIN (aa 1-74) Control Fragment | |
| RUO | |
| ARPIN | |
| Unconjugated | |
| Recombinant | |
| MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYYVLYIRPSHIHRRKF | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |