
Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Form
- (1)
- (1)
- (22,553)
- (5,021)
- (29)
- (22)
- (26)
- (27)
For Use With (Application)
- (2)
- (79)
- (3)
- (1)
- (3)
- (1)
- (3)
- (20,922)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (2)
- (3)
- (1)
- (1)
- (3)
- (5)
- (10)
- (21,512)
- (1)
- (2)
- (1)
- (1)
- (2,329)
- (1)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (8)
- (4,730)
- (134)
- (1)
- (1)
- (4)
- (1)
- (20)
- (3)
- (251)
- (25)
- (5)
- (2)
- (13)
- (1)
- (1,228)
- (2)
- (19)
- (26)
- (1)
- (2)
- (1)
- (18)
- (2)
- (3)
- (4)
- (1)
- (7)
- (3)
- (1)
- (1)
- (64)
- (3)
- (6)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (7)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (6)
- (1)
- (2,308)
- (1)
- (1)
Recombinant
- (68)
- (1)
- (27,550)
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (7)
- (1)
- (7)
- (3)
- (1)
- (4)
- (6)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (2)
- (27,262)
Species
- (1)
- (9)
- (25)
- (2)
- (1)
- (274)
- (22,473)
- (2)
- (100)
- (1)
- (2)
- (1)
- (1)
- (4)
- (8)
- (3)
- (179)
- (13)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1
–
15
of
23,718
results
Purity or Quality Grade | Affinity chromatography |
---|---|
Conjugate | Unconjugated |
Specific Reactivity | Human |
Form | Lyophilized |
pH Range | 3.0 |
Common Name | Human IL-34 Carrier-Free |
Molecular Weight (g/mol) | 52.5kDa |
Gene Symbol | IL34 |
Endotoxin Concentration | Less than 0.1ng/μg cytokine as determined by the LAL assay |
Storage Requirements | -20°C |
Protein Subtype | Recombinant |
Name | Human IL-34 Carrier-Free |
Accession Number | Q6ZMJ4 |
Regulatory Status | RUO |
Purification Method | SDS-PAGE and HPLC |
Product Type | Recombinant Protein, Carrier-Free |
Biological Activity | The activity of this protein was determined by measuring MCP-1 secretion from normal human peripheral blood cells. |
Gene ID (Entrez) | 146433 |
Formulation | 0.02M citric acid with no preservative; pH 3.0 |
Structural Form | HEK 293 cells (amino acids Asn21-Pro242; Accession # NP_001166243); contains a C-terminal 8X His tag |
Shelf Life | 12 Months |
Cross Reactivity | Hu |
Species | Human (HEK293) |
Recombinant | Recombinant |
Invitrogen™ Cholera Toxin Subunit B (Recombinant), Biotin-XX Conjugate
Made from a recombinant version of the B subunit only to provide a very high-purity product that is completely free of the toxic A subunit
Invitrogen™ Isolectin GS-IB4 From Griffonia simplicifolia, biotin-XX Conjugate
Isolated from the seeds of Griffonia simplicifolia, a tropical African legume
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | PILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human MGMT (aa 140-207) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GSVPKAATTATPAATTSPKESSEPPAPASSPEAASPTEQGPAGTSKKRGRKRGMRSRPRANSGGVDLDSSGEFASIEKMLATTDTNKFSPF |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human RREB1 (aa 1106-1196) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human CBLC (aa 9-84) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRV |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human PACT (aa 1-70) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | LDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLY |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human EphB6 (aa 37-131) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GSRLRNVKVQTALLPMNEAARSDQQAGPCVNRGTQTKKSGKSGPTRHRAQQPAASSTCGQPPPATGSEQTGPHIRDTSQALELTQYFFEAVSTQMEKWYERKIEE |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human ANKRD6 (aa 585-689) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | PGGGTNATPVVPSRAATPRSVRNKSHEGITNSVMPECKNPFKLMIGSSNAMGRLYVQELPGSQQQELHPVYPRQRLGSSEHGQKSPFRGSH |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human MBD5 (aa 128-218) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Apolipoprotein L3 Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | VVQWLYQYWPQGQPAPLPPQLQSLFQEVLQDIGVPSGHCYKPFTTFTFQPVSAGFPRLPAG |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human TMEM177 (aa 41-101) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | SGYEGVTIEPGADLLYDVPSSQAIYFENLQNSSNDLGDHSMKERDWKSSSHNTVNEELPHNCIEQPQQNDESSSKV |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human HELQ (aa 178-253) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | SCSQECGEELRASAPSPEDSVFADTGKTPQDSQAFPEAAERDWTVSLEHILASLLTEQSLVNFFEKPLDMKSKLENAKINQYNLKTFEMSHQSQSEL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human TBC1D8 (aa 1039-1135) Control Fragment |
Recombinant | Recombinant |
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | YVIDLTRAEGENRPIATLDLTLEPVTPSQREPTSLQTCASLSGKAVMEGQVDRSSQPTARRLINSDPVDLDLVEE |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human SIMC1 Control Fragment |
Recombinant | Recombinant |