missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ZNF707 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100482
Description
Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60886 (PA5-60886. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Specifications
| Q96C28 | |
| Blocking Assay, Control | |
| 286075 | |
| 100 μL | |
| Zinc finger protein 707; ZNF707 | |
| ZNF707 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ZNF707 Control Fragment | |
| RUO | |
| ZNF707 | |
| Unconjugated | |
| Recombinant | |
| QWEEPWVEDRERPEFQAVQRGPRPGARKSADPKRHCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |