missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ZFY (aa 588-635) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105660
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67210 (PA5-67210. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a zinc finger-containing protein that may function as a transcription factor. This gene was once a candidate gene for the testis-determining factor (TDF) and was erroneously referred to as TDF.Specifications
P08048 | |
Blocking Assay, Control | |
7544 | |
100 μL | |
ZFY; zinc finger protein, Y-linked; zinc finger Y-chromosomal protein; ZNF911 | |
ZFY | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ZFY (aa 588-635) Control Fragment | |
RUO | |
ZFY | |
Unconjugated | |
Recombinant | |
KTHIKTKHSKEMPFKCDICLLTFSDTKEVQQHTLVHQESKTHQCLHCD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |