missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ZBTB22 (aa 228-309) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100045
Description
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111190 (PA5-111190. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May be involved in transcriptional regulation.Specifications
| O15209 | |
| Blocking Assay, Control | |
| 9278 | |
| 100 μL | |
| 1110008J20Rik; AI265210; AI415166; Bing1; fru; fruitless; Protein BING1; ZBTB22; ZBTB22A; Zfp297; zinc finger and BTB domain containing 22; zinc finger and BTB domain-containing protein 22; Zinc finger and BTB domain-containing protein 22 A; zinc finger protein 297; ZNF297; ZNF297A | |
| ZBTB22 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ZBTB22 (aa 228-309) Control Fragment | |
| RUO | |
| ZBTB22 | |
| Unconjugated | |
| Recombinant | |
| SAVGSGERRGGGPVFPAPVVGSGGATSGKLLLEADELCDDGGDGRGAVVPGAGLRRPTYTPPSIMPQKHWVYVKRGGNCPAP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |