missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TSSC1 (aa 8-89) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP95958
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56685 (PA5-56685. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TSSC1 has been reported in PMID 9403053 as one of several tumor-suppressing sub transferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alignment of this gene to genomic sequence data suggests that this gene resides on chromosome 2 rather than chromosome 11.Specifications
Q53HC9 | |
Blocking Assay, Control | |
7260 | |
100 μL | |
EARP and GARP complex-interacting protein 1; EIPR1; Endosome-associated recycling protein-interacting protein; Golgi-associated retrograde protein-interacting protein; protein TSSC1; Tssc1; tumor suppressing subtransferable candidate 1; tumor-suppressing STF cDNA 1 protein; Tumor-suppressing subchromosomal transferable fragment candidate gene 1 protein | |
EIPR1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TSSC1 (aa 8-89) Control Fragment | |
RUO | |
TSSC1 | |
Unconjugated | |
Recombinant | |
IYGLEFQARALTPQTAETDAIRFLVGTQSLKYDNQIHIIDFDDENNIINKNVLLHQAGEIWHISASPADRGVLTTCYNRTSD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |