missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TRK fused gene (aa 105-197) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104940
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65710 (PA5-65710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TFG protein, a recently identified novel protein, is a human homolog of mouse TFG protein. It contains an N-terminal coiled-coil structure, a SPYGQ-rich region followed by octicosapeptide repeats. Research shows that TFG can modulate SHP-1 activity and is a novel member of the NF-kB pathway. The physiological functions of this protein remain largely elusive, but TFG is thought to function by associating with other proteins, including TANK and NEMO. TFG was first identified as a partner of NTRK1 and is involved in generating the thyroid TRK-T3 oncogene, as well as oncogenic rearrangements with ALK in anaplastic lymphoma and NOR1 in mixoid chondrosarcoma.Specifications
Q92734 | |
Blocking Assay, Control | |
10342 | |
100 μL | |
AI173908; HMSNP; protein TFG; SPG57; TF6; TFG; Trk-fused gene; TRK-fused gene protein; TRKT3; TRKT3 oncogene | |
TFG | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TRK fused gene (aa 105-197) Control Fragment | |
RUO | |
TRK fused gene | |
Unconjugated | |
Recombinant | |
LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |