missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TRIP (aa 278-368) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104300
Description
Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111072 (PA5-111072. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TRAIP is a protein that contains an N-terminal RING finger motif and a putative coiled-coil domain. A similar murine protein interacts with TNFR-associated factor 1 (TRAF1), TNFR-associated factor 2 (TRAF2), and cylindromatosis. The interaction with TRAF2 inhibits TRAF2-mediated nuclear factor kappa-B, subunit 1 activation that is required for cell activation and protection against apoptosis.Specifications
| Q9BWF2 | |
| Blocking Assay, Control | |
| 10293 | |
| 100 μL | |
| E3 ubiquitin-protein ligase TRAIP; RING finger protein 206; RING-type E3 ubiquitin transferase TRAIP; RNF206; SCKL9; TRAF interacting protein; TRAF-interacting protein; TRAIP; Trip | |
| TRAIP | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human TRIP (aa 278-368) Control Fragment | |
| RUO | |
| TRIP | |
| Unconjugated | |
| Recombinant | |
| LNLPPVASETVDRLVLESPAPVEVNLKLRRPSFRDDIDLNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQDVPKKICKGPRKESQLSL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |