missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TPST1 (aa 333-370) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108462
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84519 (PA5-84519. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The tyrosylprotein sulfotransferases TPST-1 and TPST-2 catalyze the sulfation of tyrosine residues within secreted and membrane-bound proteins, such as cell adhesion molecules, G-protein-coupled receptors, coagulation factors, serpins, extracellular matrix proteins, and hormones. Although both TPST-1 and TPST-2 utilize 3'-phosphoadenosine 5'-phosphosulfate as their sulfate donor, they differ in their substrate specificity.Specifications
O60507 | |
Blocking Assay, Control | |
8460 | |
100 μL | |
Protein-tyrosine sulfotransferase 1; R75054; TANGO13A; Tpst1; TPST-1; transport and golgi organization 13 homolog A; tyrosylprotein sulfotransferase 1; tyrosylprotein sulfotransferase-1 | |
TPST1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TPST1 (aa 333-370) Control Fragment | |
RUO | |
TPST1 | |
Unconjugated | |
Recombinant | |
PNYGKPDPKIIENTRRVYKGEFQLPDFLKEKPQTEQVE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |