missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TP53I11 (aa 8-59) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101958
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63940 (PA5-63940. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TP53I11 is a 177 amino acid tumor suppressor belonging to the p53-induced protein gene (PIG) family. The PIG gene family encodes redox-controlling proteins that are involved in p53 tumor suppressor activity. It is suggested that PIG11 is involved in arsenic trioxide As(2)O(3)-induced apoptosis in certain cell lines and may play a significant role in tumor suppression through promotion of cell apoptosis. The gene encoding PIG11 maps to human chromosome 11, which houses over 1,400 genes and comprises nearly 4% of the human genome.Specifications
O14683 | |
Blocking Assay, Control | |
9537 | |
100 μL | |
p53-induced gene 11 protein; Pig11; TP53I11; transformation related protein 53 inducible protein 11; Trp53i11; tumor protein p53 inducible protein 11; tumor protein p53-inducible protein 11 | |
TP53I11 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TP53I11 (aa 8-59) Control Fragment | |
RUO | |
TP53I11 | |
Unconjugated | |
Recombinant | |
PLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |