missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TACC3 (aa 182-291) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP88724
Description
Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54560 (PA5-54560. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
TACC1 is located on 8p11 chromosomal region that is amplified in approximately 15% of all breast tumor samples. The short arm of chromosome 8 also contains FGFR1 whose expression is enhanced in most breast cancer tumors. TACC family members, TACC1, TACC2, and TACC3, map very closely to the corresponding FGFR1, FGFR2, FGFR3 genes on chromosomes 4,8, and 10. Subsequently, since they are phylogenetically related, it is proposed that TACC and FGFR have similar roles in cell growth and differentiation. Also, TACC1 contains a conserved C-terminal region as in the Drosophila homolog, D-TACC. It has been shown that D-TACC is necessary for normal spindle function, and the mammalian TACC proteins appears to interact with centrosomes and microtubules in a similar manner.Specifications
Q9Y6A5 | |
Blocking Assay, Control | |
10460 | |
100 μL | |
Aint; Arnt interacting protein; ARNT-interacting protein; C86661; ERIC1; ERIC-1; Tacc3; transforming acidic coiled coil 3; transforming acidic coiled-coil containing protein 3; transforming acidic coiled-coil-containing protein 3; transforming, acidic coiled-coil containing protein 3 | |
TACC3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TACC3 (aa 182-291) Control Fragment | |
RUO | |
TACC3 | |
Unconjugated | |
Recombinant | |
VEENLSSYSLDRRVTPASETLEDPCRTESQHKAETPHGAEEECKAETPHGAEEECRHGGVCAPAAVATSPPGAIPKEACGGAPLQGLPGEALGCPAGVGTPVPADGTQTL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |