missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SYT15 (aa 209-273) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105645
Description
Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66691 (PA5-66691. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues.Specifications
Q9BQS2 | |
Blocking Assay, Control | |
83849 | |
100 μL | |
chr10 synaptotagmin; CHR10SYT; synaptotagmin 15; synaptotagmin XV; synaptotagmin XV-a; synaptotagmin-15; SYT15; SytXV | |
SYT15 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SYT15 (aa 209-273) Control Fragment | |
RUO | |
SYT15 | |
Unconjugated | |
Recombinant | |
QFDEHFIFQVSSKTITQRVLKFSVYHVDRQRKHQLLGQVLFPLKNETLVGDCRRVIWRDLEAESL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |