missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SSU72 (aa 61-114) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104201
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64405 (PA5-64405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SSU72 is a highly conserved homologue of yeast Ssu72, a CTD phosphatase and a component of the polyadenylation/ termination machinery. The human Ssu72 is located on Chromosome 1p36 and seems to represent a single gene. It was identified as a pRb binding factor and was also shown to interact with TFIIB and yeast PTA1. The ABs recognize a single band of approximately 30 Kda on immunoblots of various human cell lines but do not work well on mouse tissues.Specifications
| Q9NP77 | |
| Blocking Assay, Control | |
| 29101 | |
| 100 μL | |
| 1190002E22Rik; 1500011L16Rik; 2610101M12Rik; CTD phosphatase SSU72; FLJ13048; HSPC182; PNAS-120; RGD1307854; RNA polymerase II subunit A C-terminal domain phosphatase SSU72; RP5-832C2.2; SSU72; SSU72 homolog, RNA polymerase II CTD phosphatase; SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae); Ssu72 RNA polymerase II CTD phosphatase homolog (yeast) | |
| Ssu72 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SSU72 (aa 61-114) Control Fragment | |
| RUO | |
| SSU72 | |
| Unconjugated | |
| Recombinant | |
| YDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEER | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |