missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SLC51A (aa 1-48) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108854
Description
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139968 (PA5-139968. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids (taurocholate). Taurine conjugates are transported more efficiently across the basolateral membrane than glycine-conjugated bile acids (By similarity). Can also transport steroids such as estrone 3-sulfate and dehydroepiandrosterone 3- sulfate, therefore playing a role in the enterohepatic circulation of sterols. Able to transport eicosanoids such as prostaglandin E2 (By similarity).Specifications
Q86UW1 | |
Blocking Assay, Control | |
200931 | |
100 μL | |
organic solute transporter alpha; organic solute transporter subunit alpha; organic solute transporter, alpha subunit; OSTA; OSTalpha; OST-alpha; SLC51A; solute carrier family 51 alpha subunit; solute carrier family 51 subunit alpha; solute carrier family 51, alpha subunit | |
SLC51A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SLC51A (aa 1-48) Control Fragment | |
RUO | |
SLC51A | |
Unconjugated | |
Recombinant | |
MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |