missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SHD (aa 6-139) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP90660
Description
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53676 (PA5-53676. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May function as an adapter protein.Specifications
| Q96IW2 | |
| Blocking Assay, Control | |
| 56961 | |
| 100 μL | |
| AI413439; SH2 domain-containing adapter protein D; Shd; Src homology 2 domain containing transforming protein D; src homology 2 domain-containing transforming protein D | |
| SHD | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SHD (aa 6-139) Control Fragment | |
| RUO | |
| SHD | |
| Unconjugated | |
| Recombinant | |
| RDYLSFGGRRPPPQPPTPDYTESDILRAYRAQKNLDFEDPYEDAESRLEPDPAGPGDSKNPGDAKYGSPKHRLIKVEAADMARAKALLGGPGEELEADTEYLDPFDAQPHPAPPDDGYMEPYDAQWVMSELPGR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |