missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SEMA4A (aa 299-386) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105376
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111608 (PA5-111608. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SEMA4A is a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in guidance of axonal migration during neuronal development and in immune responses.Specifications
| Q9H3S1 | |
| Blocking Assay, Control | |
| 64218 | |
| 100 μL | |
| AI132332; CORD10; RP35; Sema B; sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4 A; Sema4a; Semab; semaphorin 4 A; semaphorin B; semaphorin-4 A; Semaphorin-B; SemB; UNQ783/PRO1317 | |
| SEMA4A | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SEMA4A (aa 299-386) Control Fragment | |
| RUO | |
| SEMA4A | |
| Unconjugated | |
| Recombinant | |
| LPFNVIRHAVLLPADSPTAPHIYAVFTSQWQVGGTRSSAVCAFSLLDIERVFKGKYKELNKETSRWTTYRGPETNPRPGSCSVGPSSD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |