missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SART3 (aa 105-219) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108784
Description
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing.Specifications
| Q15020 | |
| Blocking Assay, Control | |
| 9733 | |
| 100 μL | |
| AU045857; DSAP1; HIV-1 Tat-interacting protein of 110 kDa; hSART-3; Kiaa0156; MGC138188; mKIAA0156; mSART-3; P100; p110; p110 nuclear RNA-binding protein; p110(nrb); RP11-13G14; Sart3; SART-3; spliceosome associated factor 3, U4/U6 recycling protein; squamous cell carcinoma antigen recognised by T cells 3; squamous cell carcinoma antigen recognized by T cells 3; squamous cell carcinoma antigen recognized by T-cells 3; Tat-interacting protein of 110 kDa; Tip110; Tumor-rejection antigen SART3 | |
| SART3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SART3 (aa 105-219) Control Fragment | |
| RUO | |
| SART3 | |
| Unconjugated | |
| Recombinant | |
| LSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |