missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SAR1B (aa 40-106) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100036
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61724 (PA5-61724. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a small GTPase that acts as a homodimer. The encoded protein is activated by the guanine nucleotide exchange factor PREB and is involved in protein transport from the endoplasmic reticulum to the Golgi. This protein is part of the COPII coat complex. Defects in this gene are a cause of chylomicron retention disease (CMRD), also known as Anderson disease (ANDD). Two transcript variants encoding the same protein have been found for this gene.Specifications
| Q9Y6B6 | |
| Blocking Assay, Control | |
| 51128 | |
| 100 μL | |
| 2310075M17Rik; 2900019I22Rik; ANDD; CMRD; GTBPB; GTP-binding protein B; GTP-binding protein SAR1b; GTP-binding protein Sara; SAR1 gene homolog B; SAR1 gene homolog B (S. cerevisiae); SAR1 homolog B; SAR1a gene homolog 2; Sar1b; SAR1b gene homolog; SARA1B; SARA2; SARB; secretion associated Ras related GTPase 1 B; secretion associated, Ras related GTPase 1 B | |
| SAR1B | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SAR1B (aa 40-106) Control Fragment | |
| RUO | |
| SAR1B | |
| Unconjugated | |
| Recombinant | |
| TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |