missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RPL7A (aa 220-254) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100028
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83840 (PA5-83840. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L7AE family of ribosomal proteins. It can interact with a subclass of nuclear hormone receptors, including thyroid hormone receptor, and inhibit their ability to transactivate by preventing their binding to their DNA response elements. This gene is included in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. It is co-transcribed with the U24, U36a, U36b, and U36c small nucleolar RNA genes, which are located in its second, fifth, fourth, and sixth introns, respectively. This gene rearranges with the trk proto-oncogene to form the chimeric oncogene trk-2h, which encodes an oncoprotein consisting of the N terminus of ribosomal protein L7a fused to the receptor tyrosine kinase domain of trk. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.Specifications
P62424 | |
Blocking Assay, Control | |
6130 | |
100 μL | |
60 S ribosomal protein L7a; L7A; Large ribosomal subunit protein eL8; PLA-X polypeptide; ribosomal protein L7a; RPL7A; Surf3; SURF-3; surfeit 3; surfeit locus protein 3; thyroid hormone receptor uncoupling protein; TRUP | |
Rpl7a | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human RPL7A (aa 220-254) Control Fragment | |
RUO | |
RPL7A | |
Unconjugated | |
Recombinant | |
EAIRTNYNDRYDEIRRHWGGNVLGPKSVARIAKLE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |