missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PSD93 (aa 275-358) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP93150
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PSD-93, also known as chapsyn-110, is one of a family of plasma membrane-associated proteins found in synaptic junctions. PSD-93 is unique among family members in its expression in Purkinje neuron cell bodies and dendrites. PSD-93 has three ∽90 amino acid repeats called PDZ domains, a single interior SH3 domain, and a carboxyl-terminal guanylate kinase homology (GuK) domain that is enzymatically inactive. It is hypothesized that PDZ-domain interactions play a role in receptor and channel clustering which contributes to neuronal plasticiyt. PSD-93 is believed to participate in the clustering of certain proteins, including NMDA receptors and shaker-type potassium channels at the synaptic membrane. There are two principal modes of interaction between PSD-93 and other proteins. NMDA receptors and shaker-type potassium channels both share C-terminal sequence homology consisting of a threonine/serine-X-valine-COOH (T/SXV) motif. Other neuronal proteins that share this motif may interact with PSD-93 by binding to its PDZ domains. Neuronal nitric oxide synthase (nNOS), which lacks the T/SXV motif but which has its own PDZ domain, has been shown to associate with PSD-93 in vitro through a pseudo-homotypic PDZ-PDZ interaction.Specifications
Q15700 | |
Blocking Assay, Control | |
1740 | |
100 μL | |
A330103J02Rik; B230218P12Rik; B330007M19Rik; channel-associated protein of synapse-110; channel-associated protein of synapses, 110 kDa; Chapsyn-1; chapsyn-110; discs large 2; discs large homolog 2; discs large MAGUK scaffold protein 2; discs, large homolog 2; discs, large homolog 2 (Drosophila); discs, large homolog 2, chapsyn-110; disks large homolog 2; DLG2; Dlgh2; Gm1197; Postsynaptic density protein PSD-93; PPP1R58; protein phosphatase 1, regulatory subunit 58; PSD93; PSD-93; synaptic density protein PSD-93 | |
DLG2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PSD93 (aa 275-358) Control Fragment | |
RUO | |
PSD93 | |
Unconjugated | |
Recombinant | |
KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |