missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PRDX3 (aa 165-200) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109866
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144908 (PA5-144908. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Peroxiredoxin (Prx) is a growing peroxidase family, whose mammalian members have been known to connect with cell proliferation, differentiation, and apoptosis. Many isoforms (about 50 proteins), collected in accordance to the amino acid sequence homology, containing active site cysteine residue, and the thiol-specific antioxidant activity, distribute throughout all the kingdoms. Among them, mammalian Prx consists of 6 different members grouped into typical 2-Cys, atypical 2-Cys Prx, and 1-Cys Prx. Except Prx VI belonging to 1-Cys Prx subgroup, the other five 2-Cys Prx isotypes have the thioredoxin-dependent peroxidase (TPx) activity utilizing thioredoxin, thioredoxin reductase, and NADPH as a reducing system. Mammalian Prxs are 20-30 kilodalton in molecular size and vary in subcellular localization: Prx I, II, and VI in cytosol, Prx III in mitochondria, Prx IV in ER and secretion, Prx V showing complicated distribution including peroxisome, mitochondria and cytosol.Specifications
P30048 | |
Blocking Assay, Control | |
10935 | |
100 μL | |
antioxidant protein; antioxidant protein 1; anti-oxidant protein 1; Aop1; AOP-1; AW822249; D0Tohi1; Ef2l; HBC189; Mer5; mitochondrial thioredoxin dependent peroxide reductase; mitochondrial Trx dependent peroxide reductase; perioredoxin-3; peroxiredoxin 3; peroxiredoxin III; Peroxiredoxin-3; Prdx3; PRO1748; Protein MER5; Protein MER5 homolog; Prx; Prx 3; PRx III; Prx3; PRX-3; Prx-III; SP22; SP-22; TDXM; thioredoxin-dependent peroxide reductase, mitochondrial | |
PRDX3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PRDX3 (aa 165-200) Control Fragment | |
RUO | |
PRDX3 | |
Unconjugated | |
Recombinant | |
TKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |