missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PDCD5 (aa 1-62) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92017
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82629 (PA5-82629. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Programmed cell death 5 (PDCD5), a human apoptosis-related protein, is thought to play an early and universal role in apoptosis. PDCD5 is widely expressed and is upregulated in cells undergoing apoptosis, where it translocates rapidly from the cytoplasm to the nucleus. PDCD5 has a compact core structure of low flexibility with two mobile alpha-helices at N-terminal and a flexible unstructured C-terminal region. The charged residues are crucial for the ability of apoptosis-promoting and cell translocation of the protein. PDCD5 can facilitate apoptosis and enhance TAJ/TROY-induced paraptosis-like cell death. PDCD5 may play a dual role in the Tip60 pathway. It interacts with Tip60 and functions as a Tip60 co-activator to promote apoptosis. The nucleotide polymorphisms in the 5'-upstream region of PDCD5 affect promoter activity and the susceptibility of a Chinese population to develop chronic myelogenous leukemia and may represent a novel tumor suppressor gene influencing lung cancer.Specifications
O14737 | |
Blocking Assay, Control | |
9141 | |
100 μL | |
2200003D22Rik; AA408513; PDCD5; programmed cell death 5; programmed cell death protein 5; Protein TFAR19; TF1 cell apoptosis-related gene 19; TF-1 cell apoptosis-related protein 19; Tfar19; TFAR19 novel apoptosis-related | |
PDCD5 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PDCD5 (aa 1-62) Control Fragment | |
RUO | |
PDCD5 | |
Unconjugated | |
Recombinant | |
MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |