missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PCOLCE (aa 298-373) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104765
Description
Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83637 (PA5-83637. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.Specifications
Q15113 | |
Blocking Assay, Control | |
5118 | |
100 μL | |
astroglial cell transcript 2; Astt2; Astt-2; P14; Pcolce; PCPE; PCPE1; PCPE-1; procollagen C-endopeptidase enhancer; procollagen C-endopeptidase enhancer 1; procollagen C-endopeptidase enhancer protein; procollagen COOH-terminal proteinase enhancer 1; procollagen C-proteinase enhancer 1; procollagen C-proteinase enhancer protein; procollagen, type 1, COOH-terminal proteinase enhancer; type 1 procollagen C-proteinase enhancer protein; Type I procollagen COOH-terminal proteinase enhancer | |
PCOLCE | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PCOLCE (aa 298-373) Control Fragment | |
RUO | |
PCOLCE | |
Unconjugated | |
Recombinant | |
PKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |