missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PBX2 (aa 364-405) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100032
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63964 (PA5-63964. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PBX2 is a ubiquitously expressed member of the TALE/PBX homeobox family. PBX2 gene was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. PBX2 is a transcriptional activator which binds to the TLX1 promoter. This gene encodes a ubiquitously expressed member of the TALE/PBX homeobox family. It was identified by its similarity to a homeobox gene which is involved in t(1;19) translocation in acute pre-B-cell leukemias. This protein is a transcriptional activator which binds to the TLX1 promoter. The gene is located within the major histocompatibility complex (MHC) on chromosome 6.Specifications
P40425 | |
Blocking Assay, Control | |
5089 | |
100 μL | |
AU043397; G17; homeobox 12; homeobox protein PB x 2; HO x 12; PBX homeobox 2; Pb x 2; PB x 2 MHC; PB x 2P1; pbxy; pbxy homeodomain protein; pre B cell leukemia homeobox 2; pre B-cell leukemia transcription factor 2; pre-B-cell leukemia homeobox 2; pre-B-cell leukemia homeobox 2 pseudogene 1; pre-B-cell leukemia homeobox 3; pre-B-cell leukemia transcription factor 2; pre-B-cell leukemia transcription factor 2; pre-B-cell leukemia homeobox 2; pre-B-cell leukemia transcription factor y; Protein G17; wu:fb73g03; XXbac-BPG300A18.13 | |
PBX2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human PBX2 (aa 364-405) Control Fragment | |
RUO | |
PBX2 | |
Unconjugated | |
Recombinant | |
GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |