missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NOXO1 (aa 99-132) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP103911
Description
Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64466 (PA5-64466. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
NADPH oxidases catalyze the transfer of electrons from NADPH to molecular oxygen to generate reactive oxygen species to NOX and also target NOX to different subcellular compartments.Specifications
| Q8NFA2 | |
| Blocking Assay, Control | |
| 124056 | |
| 100 μL | |
| 2310034C04Rik; hslt; MGC20258; NADPH oxidase organizer 1; NADPH oxidase regulatory protein; Nox organizer 1; NOXO1; Nox-organizing protein 1; P41NOX; P41NOXA; P41NOXB; P41NOXC; regulatory protein P41NOX; SH3 and PX domain-containing protein 5; SH3PXD5; Snx28; Sorting nexin-28 | |
| NOXO1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human NOXO1 (aa 99-132) Control Fragment | |
| RUO | |
| NOXO1 | |
| Unconjugated | |
| Recombinant | |
| LLETYSRRLLATAERVARSPTITGFFAPQPLDLE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |