missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NEBL Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP97225
Description
Highest antigen sequence indentity to the following orthologs: Mouse (25%), Rat (25%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57915 (PA5-57915. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Nebulette encodes a nebulin like protein that is abundantly expressed in cardiac muscle. The encoded protein binds actin and interacts with thin filaments and Z-line associated proteins in striated muscle. This protein may be involved in cardiac myofibril assembly. A shorter isoform of this protein termed LIM nebulette is expressed in non-muscle cells and may function as a component of focal adhesion complexes. Alternate splicing results in multiple transcript variants.Specifications
O76041 | |
Blocking Assay, Control | |
10529 | |
100 μL | |
1200007O21Rik; A630080F05Rik; Actin-binding Z-disk protein; BB140644; D830029A09Rik; LASP2; LIM and SH3 protein 2; LIM zinc-binding domain-containing Nebulette; LIM-nebulette; Lnebl; Nebl; Nebulette | |
NEBL | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human NEBL Control Fragment | |
RUO | |
NEBL | |
Unconjugated | |
Recombinant | |
LQSWPTLARWLRRVSFSLYKPPIQAAPEPDPGNWAKSPRLSLGPEGITKGKHGFKFQGIKEKFNVSKKVLK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |