missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human NACA (aa 1995-2034) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105665
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
NACA prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). It binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. NACA also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites), and may act as a specific coactivator for JUN, binding to DNA and stabilizing the interaction of JUN homodimers with target gene promoters.Specifications
E9PAV3, Q13765 | |
Blocking Assay, Control | |
4666 | |
100 μL | |
AL022831; AL024382; Alpha-NAC; Alpha-NAC, muscle-specific form; alpha-NAC/1.9.2; Gm1878; Hom s 2; HSD48; mKIAA0363; NACA; NACA1; NAC-alpha; nascent polypeptide-associated complex alpha polypeptide; nascent polypeptide-associated complex alpha subunit; nascent polypeptide-associated complex subunit alpha; Nascent polypeptide-associated complex subunit alpha, muscle-specific form; nascent-polypeptide-associated complex alpha polypeptide; skNAC | |
NACA | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human NACA (aa 1995-2034) Control Fragment | |
RUO | |
NACA | |
Unconjugated | |
Recombinant | |
SQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |