missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MRRF (aa 97-178) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100159
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62117 (PA5-62117. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another. Ota T., Nat. Genet. 36:40-45(2004). Humphray S.J., Nature 429:369-374(2004). Zhang Y., Biochim. Biophys. Acta 1443:245-250(1998).Specifications
Q96E11 | |
Blocking Assay, Control | |
92399 | |
100 μL | |
2400002D02Rik; mitochondrial ribosome recycling factor; MRFF; MRRF; MTRRF; Ribosome-recycling factor, mitochondrial; ribosome-releasing factor, mitochondrial; RRF | |
Mrrf | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MRRF (aa 97-178) Control Fragment | |
RUO | |
MRRF | |
Unconjugated | |
Recombinant | |
EALKDNFNKTLNIRTSPGSLDKIAVVTADGKLALNQISQISMKSPQLILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |