missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MRO (aa 142-248) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91433
Description
Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54550 (PA5-54550. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination. Multiple transcript variants encoding different isoforms have been found for this gene.Specifications
Q9BYG7 | |
Blocking Assay, Control | |
83876 | |
100 μL | |
B29; beside the Ma29 deletion; C18orf3; maestro; male-specific transcription in the developing reproductive organs; MRO; Protein B29; Protein maestro | |
MRO | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MRO (aa 142-248) Control Fragment | |
RUO | |
MRO | |
Unconjugated | |
Recombinant | |
DDENDSLRYSAFVLFGQLAAFAGRKWKKFFTSQVKQTRDSLLIHLQDRNPQVAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFFYANKIL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |