missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Moesin (aa 461-570) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP90644
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82424 (PA5-82424. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Moesin, a member of the talin-4. 1 superfamily, is a linking protein of the submembraneous actin cytoskeleton. It is expressed in macrophages, lymphocytes, fibroblastic, endothelial, epithelial, and neuronal cell lines but not in blood cells. It is involved in cell adhesion, migration, and organization of cell surface structures.Specifications
P26038 | |
Blocking Assay, Control | |
4478 | |
100 μL | |
C78546; epididymis luminal protein 70; HEL70; Membrane-organizing extension spike protein; MGC137877 protein; moesin; MSN | |
MSN | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Moesin (aa 461-570) Control Fragment | |
RUO | |
Moesin | |
Unconjugated | |
Recombinant | |
AELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQR | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |