missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Mist1 (aa 120-188) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP99943
Description
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83883 (PA5-83883. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Plays a role in controlling the transcriptional activity of MYOD1, ensuring that expanding myoblast populations remain undifferentiated. Repression may occur through muscle-specific E-box occupancy by homodimers. May also negatively regulate bHLH-mediated transcription through an N-terminal repressor domain. Serves as a key regulator of acinar cell function, stability, and identity. Also required for normal organelle localization in exocrine cells and for mitochondrial calcium ion transport. May function as a unique regulator of gene expression in several different embryonic and postnatal cell lineages. Binds to the E-box consensus sequence 5'-CANNTG-3'.Specifications
Q7RTS1 | |
Blocking Assay, Control | |
168620 | |
100 μL | |
1810009C13Rik; basic helix-loop-helix domain containing, class B, 8; basic helix-loop-helix family member a15; basic helix-loop-helix family, member a15; Basic helix-loop-helix transcription factor (bHlH); bHlH; BHLHA15; BHLHB8; Class A basic helix-loop-helix protein 15; class B basic helix-loop-helix protein 8; class II bHLH protein MIST1; MIST1; MIST-1; Muscle, intestine and stomach expression 1 | |
Bhlha15 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Mist1 (aa 120-188) Control Fragment | |
RUO | |
Mist1 | |
Unconjugated | |
Recombinant | |
AKNYIKSLTATILTMSSSRLPGLEGPGPKLYQHYQQQQQVAGGALGATEAQPQGHLQRYSTQIHSFREG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |