missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LRRC18 (aa 114-185) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109840
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145142 (PA5-145142. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May be involved in the regulation of spermatogenesis and sperm maturation.Specifications
| Q8N456 | |
| Blocking Assay, Control | |
| 474354 | |
| 100 μL | |
| 4930442L21Rik; leucine rich repeat containing 18; leucine-rich repeat-containing protein 18; LRRC18; Mtlr1; testis-specific LRR protein; UNQ933; UNQ9338; UNQ9338/PRO34010; VKGE9338 | |
| Lrrc18 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human LRRC18 (aa 114-185) Control Fragment | |
| RUO | |
| LRRC18 | |
| Unconjugated | |
| Recombinant | |
| PVELKQLKNIRAVNLGLNHLDSVPTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGES | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |