missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LHX2 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105675
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64870 (PA5-64870. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution.Specifications
P50458 | |
Blocking Assay, Control | |
9355 | |
100 μL | |
ap; apterous; hLhx2; Homeobox protein LH-2; LH2; Lh-2; LH2A; LHX2; LIM homeo box protein 2; LIM homeobox 2; LIM homeobox protein 2; LIM HOX gene 2; LIM/homeobox protein Lhx2; Lim2; MGC138390 | |
Lhx2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human LHX2 Control Fragment | |
RUO | |
LHX2 | |
Unconjugated | |
Recombinant | |
ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAHFNHADVAAAAAAAAAAKSAGLGSAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAYN | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |