missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human IFRD2 (aa 204-289) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105453
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66999 (PA5-66999. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
IFRD2 is a protein coding gene.Specifications
Q12894 | |
Blocking Assay, Control | |
7866 | |
100 μL | |
1810034A24Rik; AA470234; AI838527; IFNRP; IFRD2; interferon related developmental regulator 2; interferon-related developmental regulator 2; interferon-related protein; Protein SKMC15; SKMc15; SM15 | |
IFRD2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human IFRD2 (aa 204-289) Control Fragment | |
RUO | |
IFRD2 | |
Unconjugated | |
Recombinant | |
CLACLESVFSRFYGLGGSSTSPVVPASLHGLLSAALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIALLFE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |