missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human HTR2B (aa 393-455) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP107272
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
HTR2B is a g-protein coupled receptor for 5-hydroxytryptamine (serotonin). It functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. HTR2B also plays a role in perception of pain, regulation of behavior. It is required to normal proliferation of embryonic cardiac myocytes and normal heart development.Specifications
| P41595 | |
| Blocking Assay, Control | |
| 3357 | |
| 100 μL | |
| 5-HT 2 B receptor; 5-HT(2 B); 5-HT2B; 5-HT-2 B; 5 HT2B Receptor; 5-HT2b receptor; 5-HT-2 F; 5-hydroxytryptamine (serotonin) receptor 2 B; 5-hydroxytryptamine (serotonin) receptor 2 B, G protein-coupled; 5-hydroxytryptamine 2 B receptor; 5-hydroxytryptamine receptor 2 B; 5-hydroxytryptamine receptor 2 B variant b; AJ012488; AV377389; HTR2B; NP75 protein; serotonin receptor 2 B; Srl; Stomach fundus serotonin receptor | |
| HTR2B | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human HTR2B (aa 393-455) Control Fragment | |
| RUO | |
| HTR2B | |
| Unconjugated | |
| Recombinant | |
| RYITCNYRATKSVKTLRKRSSKIYFRNPMAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |