missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Histone Macro-H2A.1 (aa 122-189) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104915
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65647 (PA5-65647. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.Specifications
O75367 | |
Blocking Assay, Control | |
9555 | |
100 μL | |
Core histone macro-H2A0.1; H2A histone family member Y; H2A histone family, member Y; H2A.y; H2A/y; H2AF12M; H2AFY; Histone H2A.y; histone macroH2A1; histone macroH2A1.1; histone macroH2A1.2; macroH2A1; MACROH2A1.1; macroH2A1.2; medulloblastoma antigen MU-MB-50.205; mH2A1 | |
MACROH2A1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human Histone Macro-H2A0.1 (aa 122-189) Control Fragment | |
RUO | |
Histone Macro-H2A0.1 | |
Unconjugated | |
Recombinant | |
GKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |