missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GSPT2 (aa 77-129) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100487
Description
Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60824 (PA5-60824. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ERF3B encodes a GTPase that belongs to the GTP-binding elongation factor family. The encoded protein is a polypeptide release factor that complexes with eukaryotic peptide chain release factor 1 to mediate translation termination. This protein may also be involved in mRNA stability.Specifications
| Q8IYD1 | |
| Blocking Assay, Control | |
| 23708 | |
| 100 μL | |
| eRF3b; Eukaryotic peptide chain release factor GTP-binding subunit ERF3B; eukaryotic peptide chain release factor subunit 3 b; FLJ10441; G1 to S phase transition 2; G1 to S phase transition protein 2 homolog; GSPT2; GST2; RGD1563213 | |
| GSPT2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GSPT2 (aa 77-129) Control Fragment | |
| RUO | |
| GSPT2 | |
| Unconjugated | |
| Recombinant | |
| TQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVT | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |