missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GRID2IP (aa 823-926) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100009
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60985 (PA5-60985. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Specifications
| A4D2P6 | |
| Blocking Assay, Control | |
| 392862 | |
| 100 μL | |
| Delphilin; GluR-delta2 philic-protein; glutamate receptor, ionotropic, delta 2 (Grid2) interacting protein; glutamate receptor, ionotropic, delta 2 (Grid2) interacting protein 1; glutamate receptor, ionotropic, delta 2-interacting protein 1; Grid2 interacting protein; GRID2IP; L-delphilin | |
| GRID2IP | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GRID2IP (aa 823-926) Control Fragment | |
| RUO | |
| GRID2IP | |
| Unconjugated | |
| Recombinant | |
| SETSHMSVKRLRWEQVENSEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFRKKEVVEILSHKKAYNTSILLAHLKLSPAELRQVLMSMEP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |