missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GPX8 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104143
Description
Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57787 (PA5-57787. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GPX8 (Probable glutathione peroxidase 8) is also named as GSHPx-8 and belongs to the glutathione peroxidase family. Glutathione peroxidase (GPx) reduces hydroperoxides, including hydrogen peroxides, in the presence of reduced glutathione as a means of protecting organisms from oxidative damage. Several GPx isozymes have been identified in animal cells and these have been classified into different groups according to their cellular location and substrate specificity. In humans, eight types of GPx have been identified from GPx1 to GPx8. The full length GPX8 has 209 amino acids and the molecular weight is 24 kDa.Specifications
Q8TED1 | |
Blocking Assay, Control | |
493869 | |
100 μL | |
2310016C16Rik; AU017063; EPLA847; glutathione peroxidase 8; glutathione peroxidase 8 (putative); GPX8; GPx-8; GSHPx-8; probable glutathione peroxidase 8; RGD1307506; UNQ847; UNQ847/PRO1785 | |
GPX8 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GPX8 Control Fragment | |
RUO | |
GPX8 | |
Unconjugated | |
Recombinant | |
WKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVII | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |