missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GNL1 (aa 236-326) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104905
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65622 (PA5-65622. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The GNL1 gene, identified in the human major histocompatibility complex class I region, shows a high degree of similarity with its mouse counterpart. The GNL1 gene is located less than 2 kb centromeric to HLA-E, in the same transcriptional orientation. GNL1 is telomeric to HLA-B and HLA-C.Specifications
| P36915 | |
| Blocking Assay, Control | |
| 2794 | |
| 100 μL | |
| G protein nucleolar 1 (putative); Gnal1; Gna-rs1; GNL1; GTP-binding protein HSR1; GTP-binding protein MMR1; guanine nucleotide binding protein, related sequence 1; guanine nucleotide binding protein-like 1; guanine nucleotide-binding protein-like 1; HSR1; HSR1 GTP-binding protein; Mmr1 | |
| GNL1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GNL1 (aa 236-326) Control Fragment | |
| RUO | |
| GNL1 | |
| Unconjugated | |
| Recombinant | |
| VAWKHYFHQHYPQLHVVLFTSFPRDPRTPQDPSSVLKKSRRRGRGWTRALGPEQLLRACEAITVGKVDLSSWREKIARDVAGATWGNGSGE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |