missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GALNT4 (aa 494-567) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105670
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67407 (PA5-67407. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. In vitro, the encoded protein can complement other GalNAc-Ts in the complete O-glycosylation of the mucin-1 tandem repeat and can O-glycosylate the P-selectin glycoprotein ligand-1 molecule. The coding region of this gene is contained within a single exon.Specifications
Q8N4A0 | |
Blocking Assay, Control | |
8693 | |
100 μL | |
AV011803; GALNACT4; GalNAc-T4; Galnt4; Polypeptide GalNAc transferase 4; polypeptide GalNAc transferase-T4; polypeptide N-acetylgalactosaminyltransferase 4; pp-GaNTase 4; ppGaNTase-T4; protein-UDP acetylgalactosaminyltransferase 4; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 4; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 4; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 4 (GalNAc-T4) | |
GALNT4 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GALNT4 (aa 494-567) Control Fragment | |
RUO | |
GALNT4 | |
Unconjugated | |
Recombinant | |
IRFNSVTELCAEVPEQKNYVGMQNCPKDGFPVPANIIWHFKEDGTIFHPHSGLCLSAYRTPEGRPDVQMRTCDA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |