missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FBXO46 (aa 190-268) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100559
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61953 (PA5-61953. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex.Specifications
| Q6PJ61 | |
| Blocking Assay, Control | |
| 23403 | |
| 100 μL | |
| 20D7-FC4; F-box only protein 34-like; F-box only protein 46; F-box protein 46; FBX46; FBXO34L; FBXO46 | |
| FBXO46 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FBXO46 (aa 190-268) Control Fragment | |
| RUO | |
| FBXO46 | |
| Unconjugated | |
| Recombinant | |
| YPRPTTPAPVVFVSAEQGGPAKGVGSERRSGGGDCSRVAEAVAHFEAQRDSPPTKGLRKEERPGPGPGEVRIAFRISNG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |